← Files NVIDIA BioNeMo Agent ToolkitARCHIVED FILE
skills/openfold2-nim/SKILL.md
7.49 KB · Oct 4, 2026 · 12:30 UTC
---
name: openfold2-nim
description: >
Use this skill for OpenFold2, NVIDIA's BioNeMo NIM microservice for monomer protein structure prediction. Invoke whenever the user mentions OpenFold2, AlphaFold2-like monomer folding, protein sequence-to-structure prediction, A3M MSAs, mmCIF templates, hosted NVIDIA API calls, or local Docker deployment.
license: Apache-2.0 AND CC-BY-4.0
compatibility: "requests>=2.28"
allowed-tools: Bash, Read, Write, AskUserQuestion
---
# OpenFold2 NIM
Predict a single protein-chain structure from an amino-acid sequence, with
optional A3M multiple sequence alignments and mmCIF templates. Use this
`SKILL.md` for basic hosted/local NIM use; load supplemental files only when
the task needs deeper context:
- `references/api.md`: exact endpoints, schemas, Docker flags, response fields.
- `references/science.md`: model scope, strengths, limitations, and handoffs.
- `references/parameters.md`: MSA, template, model-selection, and relax effects.
- `references/validation.md`: artifact and scientific sanity checks.
- `references/examples.md`: compact hosted/local payload patterns.
## Choose Mode
Ask only when context is unclear:
> Hosted NVIDIA API or local Docker NIM?
- Hosted URL: `https://health.api.nvidia.com/v1/biology/openfold/openfold2/predict-structure-from-msa-and-template`
- Local URL: `http://localhost:8000/biology/openfold/openfold2/predict-structure-from-msa-and-template`
- Local readiness: `http://localhost:8000/v1/health/ready`
Mode difference: hosted and local use the same prediction path except local
does not include `/v1/`. Hosted requests use `Authorization: Bearer
$NGC_API_KEY`; local inference requests use no auth header after readiness.
## Auth And Environment
Do not print API keys. Confirm they exist with shell tests, not echoes.
Hosted needs `NGC_API_KEY` in the request header. Supported local Docker
startup uses `NGC_API_KEY`, or `NVIDIA_API_KEY` as a fallback, plus
`LOCAL_NIM_CACHE`. A repo-root `.env` file may be sourced as a local override.
## Local Docker
Use the official OpenFold2 NIM image and mount `LOCAL_NIM_CACHE` at
`/opt/nim/.cache`. Current docs recommend at least 80 GB disk, 64 GB system
RAM, 8 CPU cores, and one supported GPU; the container is roughly 55 GB and
first startup downloads about 10 GB of model parameters.
When writing local setup commands, copy the preflight below exactly. Do not
drop `.env`, `NVIDIA_API_KEY`, `LOCAL_NIM_CACHE`, or the no-auth local request.
```bash
set -a
[ -f .env ] && . ./.env
set +a
if [ -z "${NGC_API_KEY:-}" ] && [ -n "${NVIDIA_API_KEY:-}" ]; then
export NGC_API_KEY="$NVIDIA_API_KEY"
fi
: "${NGC_API_KEY:?Set NGC_API_KEY or NVIDIA_API_KEY}"
: "${LOCAL_NIM_CACHE:?Set LOCAL_NIM_CACHE}"
echo "$NGC_API_KEY" | docker login nvcr.io --username '$oauthtoken' --password-stdin
export NIM_TEST_GPU="${NIM_TEST_GPU:-0}"
mkdir -p "${LOCAL_NIM_CACHE}"
chmod 777 "${LOCAL_NIM_CACHE}"
docker run --rm --name openfold2 \
--runtime=nvidia \
--gpus "device=${NIM_TEST_GPU}" \
-e NGC_API_KEY \
-v "${LOCAL_NIM_CACHE}:/opt/nim/.cache" \
-p 8000:8000 \
nvcr.io/nim/openfold/openfold2:latest
```
Readiness check:
```bash
until curl -sf http://localhost:8000/v1/health/ready; do sleep 5; done
```
## Request Pattern
Use Python `requests`; curl escaping is fragile for A3M/mmCIF text. The
`sequence` field is required. `input_id`, `alignments`, `selected_models`,
`relax_prediction`, `use_templates`, and `explicit_templates` are optional.
```python
import os
import requests
hosted = True
url = (
"https://health.api.nvidia.com/v1/biology/openfold/openfold2/predict-structure-from-msa-and-template"
if hosted
else "http://localhost:8000/biology/openfold/openfold2/predict-structure-from-msa-and-template"
)
headers = {"Content-Type": "application/json"}
if hosted:
headers["Authorization"] = f"Bearer {os.environ['NGC_API_KEY']}"
seq = "MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPT"
payload = {
"sequence": seq,
"input_id": "kras_fragment",
"selected_models": [1],
"relax_prediction": False,
"alignments": {
"uniref90": {
"a3m": {
"alignment": f">query\n{seq}",
"format": "a3m",
}
}
},
}
response = requests.post(url, headers=headers, json=payload, timeout=300)
response.raise_for_status()
result = response.json()
```
Payload gotchas:
- OpenFold2 is monomer-only. For protein-ligand, protein-DNA/RNA, or
multi-chain complexes, use OpenFold3 or Boltz2 instead.
- `sequence` must use valid amino-acid IUPAC symbols.
- Hosted API docs list sequence length 1-1000; local docs say current NIM
supports sequences up to 2048 residues on supported hardware.
- A3M alignments go under `alignments` by database name, then `a3m` with
`alignment` and `format`. When the user needs to create or deepen an MSA,
hand off to `msa-search-nim` / MSA Search and map its A3M output into this
`alignments` shape.
- Starting with OpenFold2 2.0.0, use `explicit_templates` with mmCIF content;
do not write new HHR-template examples.
- `selected_models` chooses AlphaFold2/OpenFold parameter sets 1-5. Select one
or two models for smoke tests; use all five for stronger production runs.
## Save And Interpret Output
The response includes one prediction per selected model, ordered by confidence.
Save every returned structure-like text field and the full JSON response so
field-shape differences are auditable. Production answers should explicitly
write `.pdb` or `.cif` artifacts, preserve the response JSON, and print any
confidence/ranking fields the service returns.
```python
from pathlib import Path
import json
Path("openfold2_response.json").write_text(json.dumps(result, indent=2))
def save_strings(obj, prefix="openfold2"):
i = 0
if isinstance(obj, dict):
for key, value in obj.items():
if isinstance(value, str) and ("ATOM" in value or value.lstrip().startswith("data_")):
i += 1
ext = "cif" if value.lstrip().startswith("data_") else "pdb"
Path(f"{prefix}_{key}_{i}.{ext}").write_text(value)
elif isinstance(value, (dict, list)):
i += save_strings(value, f"{prefix}_{key}")
elif isinstance(obj, list):
for idx, value in enumerate(obj, start=1):
if isinstance(value, (dict, list)):
i += save_strings(value, f"{prefix}_{idx}")
return i
saved = save_strings(result)
print(f"saved {saved} structure artifact(s)")
```
For production monomer runs:
- Use `selected_models: [1, 2, 3, 4, 5]` unless the user requests a smoke test.
- Use `relax_prediction: True` in Python payloads when relaxation is desired;
JSON examples may show `true`.
- State the sequence length caveat: hosted API docs list 1-1000 residues, while
local support-matrix docs list up to 2048 residues on supported hardware.
- If the task is a complex rather than a monomer, redirect to OpenFold3 or
Boltz2.
Treat tiny toy sequences and single-sequence MSAs as API smoke tests, not
quality evidence. For scientific interpretation and validation, read
`references/science.md` and `references/validation.md`.
## Troubleshooting
- `401`: missing, expired, or unauthorized NGC API key.
- `422`: invalid amino-acid characters, sequence too long, malformed A3M, bad
`selected_models`, or malformed mmCIF template object.
- Local `404`: remove `/v1/` from the prediction URL.
- Weak structures: use MSA Search to generate deeper A3M alignments and add
biologically relevant mmCIF templates when appropriate.
- Local startup stalls: first run downloads parameters into `LOCAL_NIM_CACHE`.
SHA-256: ba567cd67dbdf6f1863ed2120c8f0df61d0bab8f2286ea4bfb382d047924efd3